SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018923 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018923
Domain Number 1 Region: 175-225
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000153
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000018923
Domain Number - Region: 12-58
Classification Level Classification E-value
Superfamily RING/U-box 0.06
Family Zf-UBP 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018923   Gene: ENSFCAG00000025850   Transcript: ENSFCAT00000024855
Sequence length 344
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:91379569:91425663:1 gene:ENSFCAG00000025850 transcript:ENSFCAT00000024855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAAGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECAFCYCHRHAEAHRQKFPSHHLAQY
VHGAAPAWTADAPGQGDAKEDAQAKVENERDVESEVGEESESEEDSESEEESETEEESED
ESDEDSEDDSEEEMEDEQESEAEEDNQEGESEAEGETEAESEFDPEIEMEAERVAKRKCP
DHGLDLSTYCQEDKQLICVLCPVIGTHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVER
LKFKSSDPKVTRDQMKVFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQ
SHMDRLMTQMAQAKEQHDTSNESAEPKAEGVNEGHKVYVESLQM
Download sequence
Identical sequences ENSFCAP00000018923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]