SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018949 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018949
Domain Number 1 Region: 45-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.43e-30
Family SCAN domain 0.00016
Further Details:      
 
Domain Number 2 Region: 165-213
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-19
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018949   Gene: ENSFCAG00000027881   Transcript: ENSFCAT00000032227
Sequence length 244
Comment pep:novel chromosome:Felis_catus_6.2:E2:1862110:1870934:1 gene:ENSFCAG00000027881 transcript:ENSFCAT00000032227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGQAVKMVHVTDVLAILKNPQLFHLHDQEENPETIPIRSPGALKASHQTFRHVQYLPVT
GPHPAVSQIQELCRQWLQPETHTKQQMMEQLMLEQFLSTLPEEVQTWVRSKQPKNSKEAG
ALVAGLIQACGEKGFPAQDFVLAEKRNTKKQKKDTEMSENPLSAEPQELVTFQDVAVDFS
LEELTYLSAAQRNLYREVMLENYRNLVSLESEIPSLSSHPEARWFAFPDRLHVFVASARI
PILV
Download sequence
Identical sequences ENSFCAP00000018949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]