SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018981 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018981
Domain Number 1 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 191-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 457-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-19
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 121-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 550-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 274-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018981   Gene: ENSFCAG00000028864   Transcript: ENSFCAT00000023082
Sequence length 626
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E3:20183746:20187885:-1 gene:ENSFCAG00000028864 transcript:ENSFCAT00000023082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAVEPWGPDLQGAEEREQLRGARTGLGSENVEIAQPDEFEHPPQEDDLGFKEEEDPAP
GHEVGNASLKPEGIQTWDDLWVQREGPGKPQARDRGPRLLGEPRWGQASDRAAVCGECGK
SFRQMSDLVKHQRTHTGEKPYKCGVCGKGFGDSSARIKHQRTHSGEKPYRARPPAQGPPK
IPRSRIPAGERPTICGECGKSFRQSSDLVKHQRTHTGEKPYKCGICGKGFGDSSARIKHQ
RTHRGEQPPRPVVPRRQPSRAATAAPQGPKAQDKPYICTDCGKRFVLSCSLLSHQRSHLG
PKPFGCDVCGKEFARGSDLVKHLRVHTGEKPYLCPECGKGFADSSARVKHLRTHSGERPH
ACPECDRTFSLSSTLLRHRLTHMEPQDFSFPGYPLAPLIPSPPPSSSPPPPPLGTSPPLT
PRSPSHSGDGPFGLPGLEPEPGGPQAGEPPPPLAGDKPHKCPECGKGFRRSSDLVKHHRV
HTGEKPYLCPECGKGFADSSARVKHLRTHRGERARPPPPSTLLRPHNPPGPAPMAPRPRV
RAQPSGPSQPHVCGFCGKEFPRSSDLVKHRRTHTGEKPYKCAECGKGFGDSSARIKHQRG
HLVLRPFGTGDGRARPLKEEPPTGLE
Download sequence
Identical sequences M3WX92
XP_003998705.1.62641 XP_006942213.1.62641 ENSFCAP00000018981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]