SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019037 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019037
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.68e-28
Family Ras-binding domain, RBD 0.00000284
Further Details:      
 
Domain Number 2 Region: 754-851
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-22
Family PDZ domain 0.0000272
Further Details:      
 
Domain Number 3 Region: 162-258
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.07e-20
Family FHA domain 0.00000306
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000019037
Domain Number - Region: 1119-1126
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019037   Gene: ENSFCAG00000000864   Transcript: ENSFCAT00000023778
Sequence length 1564
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:152274397:152365233:1 gene:ENSFCAG00000000864 transcript:ENSFCAT00000023778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPG
AQHSDENGAKETILDDDECPLQIFREWPTDRGVLVFQLKRRPPDYVPKKTKKHVDGKLVK
GKERAEGSGYGSALPPEKLPYLVELSPGRRSHFAYYSYHTYEADGSDSRDKPKLYRLQLS
VTEVGTEKFEENSIQLFGSGIQPHHCDLTNMDGVVTVTPRSMDAETYVEGQRISETTMLQ
SGMKVQFGASHVFKFVDPSQDHAVAKRPVDGGLTAKGPRQKPGIVQETTFDLGGDVHSGA
ALPASKSATRLDGDRALPAPSTAERGTVKPMLRLEQQDYRRQSIRTQDALGPELILPASI
EFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSSQYRPDVSPTERTHKVIA
IVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQM
AFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMALLRRCRVNAALTIQ
LFSQLFHFINMWLFNRLVTDPESGLCSHYWGAIIRQQLGHVEAWAEKQGLELAADCHLSR
IVQATTLLTMDKYAPEDTPNINSTCFKLNSLQLQALLQNYHCAPDEPFVPTDLIENVVAV
AENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNVPNGLQEFLDPLCQRGFC
RLIPHARSPGTWTIYFEGADYESHLLRENTELAQPLRKEPEIITVTLKKQNGMGLSIVAA
KGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVV
TLEVAKQGAIYHGLATLLNQPSPMMQRVSDRRGSGKPRPKSEGFELYNNSAQNGSPESPQ
LPWAEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSAYAPGAAAKITSVSTGNL
CTEEQTPPPRPEAYPIPTQTYTREYFTFPASRSQDRVAPPQNQWPNYEEKPHVHTDGHQS
GPAMQRVTRSQEELREDKAYQLERHRLEAVLDRKSDSDVWIQPSSSVGSSTSSQEHLDPC
SKSGTPASTLTKSGPGRWKTPASAQPLPAAPPPAQTDLPPPPPPPPAHYAGDFDGIPVDL
PLPPPPSGQAAAERRKREEQQRWYEKEKARLEEERDRKRREQERKLGQMRSQALNPAAFS
PVTVAHTKPEKPSTLQRPQDTVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDP
WKRDAREKLEKQQQMHIVDMLSREIRELQSKPERSAEDSDRLRKLMLEWQFQKRLQESKQ
KDEDDEEEEDDDVDTMLIMQRLEAERRARLQDEERRRQRQLDDMRRREAEDRARQEEERT
KRDAEDKRRQEEGYYSRLEAERRRQHAEAERRLLEPEEPGLGRPPLPRGYELPAPSSPAA
APPPPPQRTASSLQAPALSPDSLYTARLVAYHEEEEEEDCSLAGKGPNSSVGSSGAAIGA
RDGSRDPRERLAKSHDADLPGNSGAPENLTFKERQRLFSQGQDVSNKVKASRKLTELENE
LNTK
Download sequence
Identical sequences ENSFCAP00000019037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]