SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019082 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019082
Domain Number 1 Region: 10-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000018
Family V set domains (antibody variable domain-like) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019082   Gene: ENSFCAG00000031358   Transcript: ENSFCAT00000025842
Sequence length 289
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:67400293:67404926:1 gene:ENSFCAG00000031358 transcript:ENSFCAT00000025842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAQRWSMHVPAEVSAAAGEAAVLPCTFTHPHRHYDGPLTAIWRAGEAYAGPQVFRCAAA
RGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDGRYFCRVEFAGDVHDRYESRH
GIRLRVTGERRALVPAPFPAPSRGLSGCRHCARRGIESTAKAAMGYVLCALKGTRSPLRG
GGGGNAQGAHSAQYFARLWHKELXRAEASVYLFRFHGASGASALALPLGALGLKALLLLG
VLAARAVARRRPEHPVAQDTPPRPQAQESNYENLSQMSPRDPPAATCLP
Download sequence
Identical sequences ENSFCAP00000019082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]