SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019193 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019193
Domain Number 1 Region: 56-120
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000019193
Domain Number - Region: 187-226
Classification Level Classification E-value
Superfamily STAT 0.0628
Family STAT 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019193   Gene: ENSFCAG00000022290   Transcript: ENSFCAT00000024100
Sequence length 283
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:505697:523706:1 gene:ENSFCAG00000022290 transcript:ENSFCAT00000024100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVNPWASWGVLTDQSWGMAAVDPWTSWALCPQDSAWPVEESPKEERKVTGLPTAQVQE
PVTFKDVAVDFTQEEWGQLDPIQRTLYRDVMLETYGHLLSVGVGNQIAKPEVISLLEQGE
EPWSVEQAYPQSTCPEWMRNLESKALIPTQSIFEEEQSHSMKLERYIWDDPWFSRLEVLG
CKDQLEMYHMNQSTAMRQMVFMQKQVLSQRGSEFCELGAECSQSLNFVPSQRVSQIEHFY
KPDTNAESWRCNSAIMYADKITCGNHDYDKTFYQSIQPNQPER
Download sequence
Identical sequences ENSFCAP00000019193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]