SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019298 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019298
Domain Number 1 Region: 122-520
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.36e-139
Family Myotubularin-like phosphatases 0.0000000271
Further Details:      
 
Domain Number 2 Region: 6-112
Classification Level Classification E-value
Superfamily PH domain-like 4.43e-17
Family GRAM domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000019298
Domain Number - Region: 512-560
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0314
Family MED7 hinge region 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019298   Gene: ENSFCAG00000029234   Transcript: ENSFCAT00000023717
Sequence length 638
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:4930126:4969327:-1 gene:ENSFCAG00000029234 transcript:ENSFCAT00000023717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSHQKETWILHHHIALVEKLA
LTTSGCPLVIQCKNFRIVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSE
RLRGWQLIDLAEEYKRMGVPNSNWQLSDANREYKICETYPRELYVPRIASKPIIVGSSKF
RSKGRFPVLSYYHEHKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPVNRYMYVMDTR
PKHRMQSWWATQKDIGRIILNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQK
LLEVNGTKGLSVSDFYSGLESSGWLRHIKAVMDAAIFLAKAITVESASVLVHCSDGWDRT
SQVCSLGSLLLDSYYRTIKGFMVLIEKDWISFGHKFSERCGHLDGDPKEVSPVFTQFLEC
VWHLTEQFPQAFEFNEAFLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLD
DQKKYLNPLYTSKSPKFTVLEPNTVSFNFKFWRNMYHQFDRTLHPRQSVFNIITNMNEQN
KQLEKDIKDLESKIKQCKNKPTDGILTKELIHSVHPESPTLKTSLCFKEQTLLPVNHALR
TIEGSNPADNRYSEYAEEFSKSEPGVVSLEYGVARMTC
Download sequence
Identical sequences ENSFCAP00000019298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]