SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019392 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019392
Domain Number 1 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-27
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 366-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-26
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 142-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.11e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 407-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 103-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019392   Gene: ENSFCAG00000022842   Transcript: ENSFCAT00000022702
Sequence length 464
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:92169020:92170414:-1 gene:ENSFCAG00000022842 transcript:ENSFCAT00000022702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREGLWHSSLGETWEPDNWLDGQQKNQDRPLGQVSVTHEETLTERRTCGGNEFARCSSQ
GSILDIKQSIPVGKRPHNQNPHKEDTKQNSELIKTQSMFVGKKIYECNECRKTFSQSSSL
LKHQRIHTGEKPYKCNVCGKHFIERSSLTVHQRIHTGEKPYKCNECGKTFSQSMNLTVHQ
RTHTGEKPYQCKECGKAFRKNSSLIQHERIHTGEKPYKCSECGKAFTQSMNLTVHQRTHT
GEKPYECNECGKAFSQSMHLIVHQRSHTGEKPYECSECGKAFSKSSTLTLHQRNHTGEKP
YKCNKCGKSFSQSTYLIEHQRLHSGVKPFECNQCGKAFSKNSSLTQHRRIHTGEKPYECM
VCGKHFTGRSSLTVHQVIHTGEKPYECNECGKAFSQSAYLIEHQRIHTGEKPYECDQCGK
AFIKNSSLIVHQRTHTGEKPYQCNECGKAFSRSTNLTRHQRTHT
Download sequence
Identical sequences M3WYF2
XP_019686338.1.62641 ENSFCAP00000019392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]