SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019408 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019408
Domain Number 1 Region: 153-274
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.93e-30
Family Dual specificity phosphatase-like 0.00033
Further Details:      
 
Domain Number 2 Region: 9-141
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.83e-23
Family Cell cycle control phosphatase, catalytic domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019408   Gene: ENSFCAG00000024920   Transcript: ENSFCAT00000031520
Sequence length 335
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:115721507:115731136:1 gene:ENSFCAG00000024920 transcript:ENSFCAT00000031520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDRLPRKVMDAKKLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICCSKLVKRRLQ
QGKVTIAELIQPAVRGQVEATEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVA
ILTGGFATFSSCFPGLCEGKPAALLPMSLSQPCLPVPSVGLTRILPHLYLGSQKDVLNKD
LMTQNGISYVLNASNSCPKPDFICESRFMRIPINDNYCEKLLPWLDKCIEFIDRAKLSSC
QVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYSLPPPATKRPSGQRSRPRRRNSSAEAA
RWSSRRAWWRGARAARSWPPWASRPASRAAWRSSR
Download sequence
Identical sequences ENSFCAP00000019408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]