SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019430 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019430
Domain Number 1 Region: 671-778
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000471
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 2 Region: 977-1086
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000589
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 3 Region: 858-953
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000878
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019430   Gene: ENSFCAG00000010934   Transcript: ENSFCAT00000031410
Sequence length 2215
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:83726115:84003410:1 gene:ENSFCAG00000010934 transcript:ENSFCAT00000031410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSLQDICEDISDHVEQIHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRE
RILQGLQDANGNYTRQTDILQAFSEETNEGRLDSLTEVDDSGQLTIKCSQNYLSLDCGIT
AFELSDYSPSEDLLGGLGDMTSSQVKTKPFDSWSYSEMEKEFPELIRSVGLLTVATDPVP
PNCSEAVREERSQVSLSADDRGGCEKNSASTVEEPPGLMPGMSSSGEALTNAEQPPSEAV
KQESSSSSQLGAKNQQPLPCENATPKRSIRDCFNYNEDSPTQPTLPKRGLFLKEETFKNN
LKGTVTNKQMADLKPELSRSTPSLVEAPDRSKLCLVLQSSYPNSPSAASQSYECLHKVAD
GNLENTVKSHIKEISSSLGRLSDCHKEKPRLKKPHKAPAEVPLCRTPKRGAGSGKQAENT
RSSVVSNGIPSGTSNATERPETDSVSTSSLEPCNQRSWDAKLPVRSETSSSPPLTQSSES
SAGSDSILSPVPLLSKHKSKKSYSSSPSHVTRNGQVVEAWYGSDEYLALPSHLKQTEVLA
LKLENLTKLLPQKPRGETIQNIDDWELSEMNSDSEIYPTYHVKKKHTRLGRVSPSSSSDI
ASSLGESMESGPLSDILSDEELCMPLSGMKKYIDEKSERASSSEKNESHSATKSALIQKL
MQDIQHQDNYEAIWEKIEGFVNKLDEFIQWLNEAMETTENWTPPKAETDGLKLYLETHLS
FKLNVDSHCALKEAVEEEGHQLLELIASHKAEGLKDMLRMIASQWKELQRQIKRQHSWIL
RALDTIKAEILATDVSVEDEEGTGSPKAEVQLCYLEAQRDAVEQMSLKLYSEQYTSSSKR
KEEFADMSKVHSVGGNGLLDFDSEYQELWDWLIDMESLVMDSHDLMMSEEQQRHLYKRYS
VEMSIRDLKKTELLSKVEALKKGGVLLPNDLLEKVDSINEKWELLGKTLGQKIQDTMAGH
SGSGPRDLLSPESGSLVRQLEVRIKELKGWLRDTELFIFNSCLRQEKEGTMNAEKQLQYF
KSLCGEIKQRRRGVASILRLCQHLLDDRDTCNLNADHQPMQLIIVNLERRWEAIVMQAVQ
WQTRLQKKMGKESETLNVIDPGLMDLNGTSEDALEWDETDISNKLISLNEESNDLDQEPQ
PLMPSLKLEEIGGEDPGYEEEAGDHGGSQYASSVTVPSSPHIYQVYSLHNVELCEDSSMP
FLKNNPKFTSMTQPSVLTKSLSKDSSFSSTKSLPDLLGGSSLVKPCPCHGGDMSQNSGSE
SGIVSEGDTETTTNSEMCLLNMVDGSPSNLETEHLDPQMGDAVNVLKQKFKDEEERIKLP
NSSQPSISPVGCVNGKVGDLNSVTKYTPDCLGEELQGKHDVFTFYDYSYLQGSKLKLPMI
MKQSQSEKAHVEDPLLRFYFDKKSCKSKHQATELQPDAPPHEKILASASHEMDRNSYKSG
DVEKTFTGMQNARQLSLLSHSSSIESLSPGGDLFGLGILKNGSDSLQRSTSLESWLTSYK
SNEDLFSCHSSGDISVSSGSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQSSSQ
KMPFTGQLSLDIASSINEDSPASLTELSSSDELSLCSEDIVLHKNKVPESNASFRKRLTR
SVADESDVNVSMIVNVSCTSACTDDEDDSDLLSSSTLTLTEEELCIKDEDDDSSIATDDE
IYEECNLMSGLDYIKNELQTWIRPKISLTKDKRRCNISDEIKGSKDVSSSEMTNPSDTLN
IEALLNSSIKCLSENNGNGKNLSNTHEIGTKGENKKNVFKVNKDPYVADMENGNIEGTPE
RQKDKQNGISKESDNLGSTGKKNSDSEHCKCKVFMDSSDDSNIAGKESVPQTVRHRPKKC
QNHHHVENPTTASIPTEKSCPELPSETSIINRQDSEVLKPSPNDAPNMAGKSAPCCLALE
QNETEENVSVSDNISCCDCEPDVFHQKDAEDCSVHDFVKEIIDMASTALKSKSQPENEAA
APTSLTQIKEKVLEHSHRPIQLRKGDFYSYLSLSSHDSDCGEVTNYVEEKSNTPLPLDIS
DSGLEDKEDTECFFEACVEDDPDGVEPCLPHAPPNEPVSVEAALPQQAASGSSKFKDISL
VADEEDMVALSGSPHQKESDVGKEGGGLPRATVHGKSSELTTSRLGSEKESLENTGESGM
PGEHNAASAKSRVPGLSSKAKQPKDKAALHPNPKTLTCEENLLNLHEEQHKNMHR
Download sequence
Identical sequences ENSFCAP00000019430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]