SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019471 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019471
Domain Number 1 Region: 105-194
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-23
Family Second domain of FERM 0.00075
Further Details:      
 
Domain Number 2 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-21
Family First domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019471   Gene: ENSFCAG00000027785   Transcript: ENSFCAT00000027216
Sequence length 194
Comment pep:novel chromosome:Felis_catus_6.2:F1:28692488:28824003:1 gene:ENSFCAG00000027785 transcript:ENSFCAT00000027216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCALEQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQEHKAHR
Download sequence
Identical sequences ENSFCAP00000019471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]