SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019533 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019533
Domain Number 1 Region: 666-800
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-16
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 2 Region: 349-487
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000157
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 3 Region: 148-274
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000489
Family Spectrin repeat 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000019533
Domain Number - Region: 590-697
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0959
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019533   Gene: ENSFCAG00000022055   Transcript: ENSFCAT00000029518
Sequence length 826
Comment pep:novel chromosome:Felis_catus_6.2:B2:139333349:139363337:-1 gene:ENSFCAG00000022055 transcript:ENSFCAT00000029518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLLIQDLEDIEQRVPVMDAQYKMITKTAHLITKESSQEEANEMFATMSGLKERLTKVKEC
CPPLLYESQQLLIPLEELEKQMTFFYDSLAKIHEIMAVLEREAQSSALFKQKHQELSACQ
ESCKKTMTQIEKGSQNVQKFVTLSSVLKHFDQTKLHRQIADAHGAFQNMVKKIGDWKKHV
ETNSRLMKKFEESRAELEKVLRIAQEGLEEKGNPEDLLKKHTEFFSQLDQRVLNAFLKAC
DELTDILPEQEQQGLQEAVRKLHKQWKDLQGEAPYHLLHLKIDVEKNRFLASVEECRTEL
DRETTLVPQEGSEKIIKEHRIFFSDKGPHHLCEKRLQLIEELCLKLPVRDPVRNTPETCH
VTLKELRAAIDATYKKLVEDRDKWKDYTRRISEFSSWISAKETQLKGFKNEPIDTANHGE
IKHAVEEIRNGVTTKGETLNWLKSRLKILIEVSSENEAQKQGDELAKLSSSFKALIALLS
EVEKMLSNFGDCVQYKEIVKSSLGELISDSKEVQEQAEKILDTENLFEAQQLLLHHQQKT
KRISAKKRDVQQQIAQAQQGEGGMPGQVRDELRKLESTLDSMEHSREKQERRIQVTLRKW
ERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELEQTKEFSKRTEGIAVQAENLVKE
ASEIPLGPKNKQLLQQQAKTIKEQVKKLEDTLEEDIKTMEMVKNKWDHFGNNFETLSVWI
TEKEKELNALETSSSAMDMQINQIKVIIQEIESKIGCITELEEAAQSFAQFVTTGESARI
KAKLTQIRRYWEELREHAQCLEGTILGHLSQQQKFEENLRKVRMGL
Download sequence
Identical sequences ENSFCAP00000019533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]