SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019606 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019606
Domain Number 1 Region: 39-53,170-417
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-60
Family Nuclear receptor ligand-binding domain 0.000000137
Further Details:      
 
Domain Number 2 Region: 2-54
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000611
Family Nuclear receptor 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000019606
Domain Number - Region: 88-95
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0112
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019606   Gene: ENSFCAG00000022552   Transcript: ENSFCAT00000026158
Sequence length 420
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:85482661:85504271:-1 gene:ENSFCAG00000022552 transcript:ENSFCAT00000026158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYK
RDRALKQQKKAQIRANGFKLETGPPMGPPPPPPPPDYMLPPGLHAPEPKGLASGPPAGPL
GDFGAPALPMAVPSAHGPLAGYLYPTFPGRAIKSEYPEPYASPPQPGPPYGYPEPFSGGP
GVPELILQLLQLEPDEDQVRARIVGCLQEPAKGRPDQTAAFSLLCRMADQTFISIVDWAR
RCMVFKELEVADQMTLLQNCWSELLVFDHIYRQIQHGKEGSILLVTGQEVELTAVAAQAG
SLLHSLVLRAQELVLQLHALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAAL
LDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
Download sequence
Identical sequences ENSFCAP00000019606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]