SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019608 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019608
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.37e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019608   Gene: ENSFCAG00000029842   Transcript: ENSFCAT00000029962
Sequence length 148
Comment pep:novel chromosome:Felis_catus_6.2:E2:5803671:5808610:-1 gene:ENSFCAG00000029842 transcript:ENSFCAT00000029962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFSFQGWLTFRDVAIEFSQEEWECLDPAQRALYRDVMLENYRNLVSLALSPKCVIKELPP
KENSNTGEVLQTVILERHESRDAEDCGFREIQKSFHDSECQRRDGERNYEGVLVTLNKNL
TGRRDAGNEPIENRSGLSFQSRLAGVQI
Download sequence
Identical sequences ENSFCAP00000019608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]