SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019611 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000019611
Domain Number - Region: 16-136
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000254
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019611   Gene: ENSFCAG00000023306   Transcript: ENSFCAT00000030129
Sequence length 206
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:104200779:104289946:-1 gene:ENSFCAG00000023306 transcript:ENSFCAT00000030129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENFSALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPQPTSATAPPGADKSAA
GCGPFYLMRELPGSTELTGSTNLITHYNLEHSYNKFCGKKVKEKLSNFLPDLPGMIDLPG
SHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHK
QSRTQDPVPPEKAMLVSTFLIAEKAW
Download sequence
Identical sequences ENSFCAP00000019611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]