SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019698 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000019698
Domain Number - Region: 46-136
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00667
Family Glycerol-3-phosphate transporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019698   Gene: ENSFCAG00000025886   Transcript: ENSFCAT00000024422
Sequence length 256
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:132781843:132796126:-1 gene:ENSFCAG00000025886 transcript:ENSFCAT00000024422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFPGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGLCIAASEF
YKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFYFGALSF
IIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPS
HSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKEN
KDSLHSNTANRRTTPV
Download sequence
Identical sequences ENSFCAP00000019698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]