SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019842 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019842
Domain Number 1 Region: 146-301
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.03e-44
Family Dual specificity phosphatase-like 0.0000916
Further Details:      
 
Domain Number 2 Region: 12-140
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.07e-25
Family Cell cycle control phosphatase, catalytic domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019842   Gene: ENSFCAG00000028382   Transcript: ENSFCAT00000023287
Sequence length 663
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:48595725:48684246:-1 gene:ENSFCAG00000028382 transcript:ENSFCAT00000023287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHEMIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQ
DKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFSSVHL
LAGGFAEFSRCFPGLCEGKSAVVPTCISQPCLPVANIGPTRILPNLYLGCQRDVLNKELM
QQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDKSVDFIEKAKACNGCV
LVHCLAGVSRSATIAIAYIMKRMNMSLDEAYRFVKEKRPTISPNFNFLGQLLDYEKKIKN
QTGTSGPKSKLKLLHLEKPNEPVPAVSEGGQKSEMCLGPPCANSATSEAAGQRPAHPASA
PGSQPPLPEDGPLVQALSGLHLPSGKLEDSRKLKRSFSLDIKSVSYSASVAASLHGFPSS
EDALEYYKPSAALDGTGKLCQFSPVEEVSEQTPETSPDKEEANLPKKPQPARPAESQGKR
LHSVRATGGGAAQRSLFSPLHRSGSVEDNCHTSFLLGLSASQQHLAKSAAGLGLKGWHSD
ILAPQTSAPSLANSWYFATEPSRFYSASAMYGGSAGYSAYSCSQLPTGSDQAYSVRRRHK
PGDRPDSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSMEII
EVS
Download sequence
Identical sequences M3WZQ1
ENSFCAP00000019842 XP_011282073.1.62641 XP_019690088.1.62641 XP_019690089.1.62641 XP_019690090.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]