SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019880 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019880
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000107
Family PDZ domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019880   Gene: ENSFCAG00000026773   Transcript: ENSFCAT00000026175
Sequence length 185
Comment pep:novel chromosome:Felis_catus_6.2:C1:190741686:190762256:1 gene:ENSFCAG00000026773 transcript:ENSFCAT00000026175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGRLRMNDQLIAVNGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEEPT
ECGAFSKPCFENCPNAINASRRNDNSSLHPFGTYSSQDKQKELLLPSDGWAEAEVPPSPP
PHPVLELGTEDYSHSSGVDSAVYFPDQHTHFRSVTPARQPESMNLKSLLKVPRWTLVIYI
IGQRS
Download sequence
Identical sequences ENSFCAP00000019880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]