SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020007 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020007
Domain Number 1 Region: 1120-1315
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.2e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 909-1032
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-32
Family Pleckstrin-homology domain (PH domain) 0.000000497
Further Details:      
 
Domain Number 3 Region: 15-140
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020007   Gene: ENSFCAG00000022446   Transcript: ENSFCAT00000028487
Sequence length 1913
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:22548102:22625247:-1 gene:ENSFCAG00000022446 transcript:ENSFCAT00000028487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSKSKDGKEQSETVSPSEDETFSWPGPKTVMLKRTSQGFGFTLRHFIVYPPESAIQFSYK
DEENGNRGGKPRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIGKTYSQVI
ALIQNSDTTLELSVMPKDEDILQVAYSQDAYLKGNEAYSGNARNIPEPPPICYPWLPSAP
SAMAQPVEISPPDSSSSKPQTTTPVLTQPGRAYRMEIQVPPSPTDVAKSNTAVCVCNESV
RTVIVPSEKVVDLLTNRNNHTVPSHRTEEVRYGINEQTALKTVSRTTSPPSSVPTAHLIH
QTTGSRSLEPSGILLKSGNYSGHSEGISSSRPQAVDSPSVSVNHYSPNSHQHIDWKNYKT
YKEYIDNRRLHIGCRTIQERLDSLRAASQSTTDYNQVVPNRTTLQVRRRSTSHDRVPQSV
QIRQRSVSQERLEDSVLMKYCPRSASQGALTSPSVSFSNHRTRSWDYIEGQGETLENVSS
EGQIPDSNGERKQTYKWSGFTEQDDRRGIHERPRQQEIHKSFRGSNFTVAPSIVNSDNRR
MTGRGVGSVSQFKKVPPDLKTLQSNRNFQTTCGMSLSRGITQDRSPLVKVRSNSLKAPST
HVTKPSFSQNSLVSVKDQRPVNHLHQNSLLNQQPWLRTESAPDHQVETGKPPSLPGASVK
PIPQMSENYGASDLELPAPQRNQDLTLQEAEMQESNTLDNKETVILREKPPSGRQTPQPL
RHQSYILAVNDQEAGSDTTCWLPNDARREVHIKRMEERKASSTSPPGDSLASIPFIDEPT
SPSIDHDLAHIPASAVISASTPQAPQAPQAPSIATVPPSLTTSAPLIRRQLSHDQESVGP
PSLDAQPSSKTERSKSYDEGLDDYREDAKLSFKHVSSLKGIKIIDSQKSSEDSGSRKDSS
SEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLYKDKREQMTPSEE
EQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNEED
TGVTNRDLISRRIKEYNSLMSKAEQLPKTPRQSLSIRQTLLGAKSEPKTQSPHSPKEESE
RKLLRTKDDTSPPKDKGTWRKGIPSIMRKTFEKKPTATGTFGVRLDDCPPAHTNRYIPLI
VDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMADIDIQDDKWRDLNVISSLLK
SFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKRLIHDLPEHHYETLKFLSAHLKTV
AENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQHHDWFFTEEGA
EEPLTTVQEENTVESQPVPNIDHLLTNIGRTGVSPGDVSDSATSDSTKSKGSWGSGRDQY
SRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDSVFFKKESTEQCHNDLKEESKESEAL
CRKQRLVLSKENSAKKDSGAPKDEKTPPRQESAPSEEPSPPHSSRRSKSPTLSGRFPLLR
DSSRSPAAHKSSPHLEEPGSDSGPLPSTSSQASPARPPTKTSTSPESKRGEVLATVGTAT
SDCSAAPPTAYPASLDCSRLSPDVRSVAESKGDEADDERSELISEGRPVETDSESDFPVF
PAALAPDRLFRGKLQEAGKASRRNSEGSEVSCTEGSLTPSLDSRRQLFSSHKLIECDTLS
RKKSARFKSDSGSLGDAKSDREAPAITRVFDVMKKGKSTGSLLTPTRSESEKQEPTWKTK
IADRLKLRARAPADDMFGVGNQKASAEAAKRKNIKRRHTLGGHRDAAEISVLNFWKAHEQ
GAERESELSAVNRLKPKCSAQDLSISDWLARERLRTSASDLSRGETGGPQPESSRALEGA
TAHAPLSSQADAGGSPGTLASTNRPLLSSPPQSPDQINGESFQNMSQHASSAA
Download sequence
Identical sequences ENSFCAP00000020007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]