SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020066 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020066
Domain Number 1 Region: 429-564
Classification Level Classification E-value
Superfamily TIMP-like 6.12e-32
Family Netrin-like domain (NTR/C345C module) 0.031
Further Details:      
 
Domain Number 2 Region: 205-301
Classification Level Classification E-value
Superfamily Immunoglobulin 4.21e-21
Family I set domains 0.045
Further Details:      
 
Domain Number 3 Region: 382-434
Classification Level Classification E-value
Superfamily BPTI-like 8.8e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 321-377
Classification Level Classification E-value
Superfamily BPTI-like 4.26e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.013
Further Details:      
 
Domain Number 5 Region: 120-170
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000013
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 34-85
Classification Level Classification E-value
Superfamily Elafin-like 0.000000314
Family Elafin-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020066   Gene: ENSFCAG00000029597   Transcript: ENSFCAT00000023685
Sequence length 573
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:36929405:36936095:-1 gene:ENSFCAG00000029597 transcript:ENSFCAT00000023685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPGCCRLWSRWAQVTVLLLLLGVPLRGLAVPPIRYSHAGICPNDMNPNLWVDAQSTCK
RECETDQECETPEKCCPNVCGTKSCVAARYMDVRGKKGPVGMPKEATCDHFMCLQQGSEC
DIWDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRHHFTWPN
TSPLPPETTVRPTTASPETPGPDMVAPALLNHPVHQSVTVGETVSFLCDVVGRPRPEVTW
EKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQPQDAGIYTCTARNAAGVLRADFPLS
VVRGGQAAATSESSPNGTAFPTAECLKPPDSEDCGEEQTRWHFDAQANNCVTFTFGHCHR
NRNHFETYEACMLACMSGPLAACSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCEGNS
NNFESREACEESCPFPRGDQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGRALV
TVDEVLKDEKMGLKFLGREPLEVTLLHVDWTCPCPNVTVGETPLIIMGEVDGGMAMLRPD
SFVGASSSRRVRKLREVMHKKTCDVLKEFLGLH
Download sequence
Identical sequences M3X0C4
ENSFCAP00000020066 ENSFCAP00000011455 9685.ENSFCAP00000011455 XP_003996735.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]