SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020328 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020328
Domain Number 1 Region: 370-558
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.06e-66
Family Regulator of G-protein signaling, RGS 0.00000769
Further Details:      
 
Domain Number 2 Region: 767-996
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-64
Family DBL homology domain (DH-domain) 0.000000000703
Further Details:      
 
Domain Number 3 Region: 1000-1130
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-39
Family Pleckstrin-homology domain (PH domain) 0.00000125
Further Details:      
 
Domain Number 4 Region: 69-149
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-22
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020328   Gene: ENSFCAG00000026560   Transcript: ENSFCAT00000022788
Sequence length 1543
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:17499115:17649130:1 gene:ENSFCAG00000026560 transcript:ENSFCAT00000022788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSASHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVESSVIGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVVTSSRSLGDPPTVSEVEADPGDGLGRIDYSSGDAS
RPSSDSAESPKSALKERIYLEENPEKSEVIQDTDTQSLIGSPSPRMAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRR
VFLEFHQFFLDRSAHLKVSVPDEISIDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRVTLEKERACAEQIVAKIEEVLMTAQAVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKQRHPKHLSTPSSVSPEPQDSAKLRQSGLAGEGTDVGY
LPANSMSSGASGATLSQEGGKENDLGSKQVGETPASGDCMDGAPRTPNTIFDFPPPPLDQ
VQEEEWEVERVPEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPMEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSNLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLNTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSAK
PIPLPQSPPCEGDNDEEEPPKLKVEHHSISVPGLQSPDRDLGLESPLISSKPQSHSLGAS
GKSEVDDLFVAERQFAKERHADGTLQEAGASYQIPIPDPHLPASEERWALDALRNLGLLK
QLLVQQLGLAEKSTQEDWSRFLRYGTASSGVQTDSVTQNSENSKACPPGEGQVSFRTESG
DISTCYSPRTSTESSAPRDSVVLAFQDSQASNILVMDHMIMTPEMPPAEPEGSLDESGEH
FFDAREAHSDDNPSEGDGVVKKEEDVNLRISGNYLILDGYDAVQESSTDEEVASSLPPPP
TTGAPPTDSAGQQQHSPQNAHSDGALSPFTPEFLVQQRWGAMEDSCFEIQSPPSCADSQS
QIMEYIRKIEADLEHLKKVEESYNILCQRLAGSALTDKHSDKS
Download sequence
Identical sequences M3X136
ENSFCAP00000020328 XP_006936792.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]