SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020338 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000020338
Domain Number - Region: 209-219,299-336
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0191
Family Formin homology 2 domain (FH2 domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020338   Gene: ENSFCAG00000030038   Transcript: ENSFCAT00000031085
Sequence length 360
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:124997762:125011212:-1 gene:ENSFCAG00000030038 transcript:ENSFCAT00000031085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLILNILREMLEYFGVPIDQVLQIRENKDYGSARSIVRLIGKILPLEPCPRPNFELIPL
LNSVDPGDYGSVVPSFADTLRVANDEEGSYLRFRNSIWKNEEEKKMELFHPLPPVWNPLL
PAPRQNKRTKNDGPVNEAAIKKIAALEDELTFLRTQIAAVVQMQELKNRANAGLFDLSSE
PSSLGQRPSPGTAELSVKPDPFSSSVFFPPPAPPPPVPPQLSSPQRPCSLTWPGTNNTCN
SDNSANEVKRQQSGDSKTNDSHRSKSQENKDVPNMLDILKDMNKVKLRAVERSPGGRPIH
KRKRQDSHWDPVSLISHALKQKFAFQEDDSFEKENRSWESSPFSSPETSRVSYNNVKLIF
Download sequence
Identical sequences XP_006932105.1.62641 XP_011280898.1.62641 XP_019686843.1.62641 ENSFCAP00000020338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]