SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020348 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020348
Domain Number 1 Region: 359-425
Classification Level Classification E-value
Superfamily RING/U-box 4.18e-20
Family RING finger domain, C3HC4 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000020348
Domain Number - Region: 288-298
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00178
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020348   Gene: ENSFCAG00000030605   Transcript: ENSFCAT00000032003
Sequence length 431
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:173968165:173973918:1 gene:ENSFCAG00000030605 transcript:ENSFCAT00000032003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPWALAVTRWPPSAPVGQRQFSVGPSSTPGQLRGSPSREGPLASLPAQDEHLPSQQPPS
RPHLPVEEHRASAPAGRSPRMLHPASQQSPFMVDLHEQVHQGPVPLSYTVTTVTTQGFPL
PTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPLIQACTMQQLPVPYQAYPHLISSDHY
ILHPPPPAPHPQPAHMAPLGQFVSLQAQHPRMPLQRLDNDVDLRGDQHPLGSFTYSTSAP
GPALSPSMPLHYLPHDPLHQELSFGVPYSHMMPRRLSTQRYRLQQPLPPPPPPPPPPPYY
PSFLPYFLSMLPMSPTAMGPTISLDLDVDDVEMENYEALLNLAERLGDAKPRGLTKADIE
QLPSYRFNPDSHQSEQTLCVVCFSDFEARQLLRVLPCNHEFHTKCVDKWLKANRTCPICR
ADASEVPREAE
Download sequence
Identical sequences A0A2I2UM26
XP_011283545.1.62641 XP_019305927.1.44245 ENSFCAP00000020348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]