SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020380 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020380
Domain Number 1 Region: 102-192
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000337
Family Ankyrin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020380   Gene: ENSFCAG00000023899   Transcript: ENSFCAT00000032584
Sequence length 351
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:33306937:33310921:-1 gene:ENSFCAG00000023899 transcript:ENSFCAT00000032584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPSLITFTPATSASDLWKDGQQQSQPEELEPTLDGAAARAFYEALIGDESSAPEAQRS
QPEPASKRKRKKRRIMREAAAGTSGGHGQRRSLEAEDKMTQWILRAAQEGDLAELRRLLD
PREAGGAGGNINARDAFWWTPLMCAARAGQGAAVRYLLGRGAAWVGVCELGGKDAAQLAE
EAGFPEVARMVRESHGETRSPENRSQSPSPRYCETCDAHFQDSNHCTSTAHLLSLSRDLR
SPNLPLGVPTSSPGFKLLLRGGWEPGMGLGPRGEGRTNPIPTVLKRDQEGLGYRSVPQPR
VTHFLARDTRAVAGRERTPRVTTLSRREERKQKEKDRAWERDLRTYMNLEL
Download sequence
Identical sequences M3X187
XP_003985975.1.62641 XP_006931623.1.62641 XP_006931624.1.62641 XP_006931626.1.62641 XP_006931627.1.62641 XP_019685921.1.62641 9685.ENSFCAP00000007074 ENSFCAP00000007074 ENSFCAP00000020380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]