SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020388 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020388
Domain Number 1 Region: 212-321
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.37e-43
Family Retrovirus capsid protein, N-terminal core domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 5-97
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 3.24e-29
Family MMLV matrix protein-like 0.000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020388   Gene: ENSFCAG00000030282   Transcript: ENSFCAT00000025734
Sequence length 399
Comment pep:novel chromosome:Felis_catus_6.2:C1:180257503:180258716:1 gene:ENSFCAG00000030282 transcript:ENSFCAT00000025734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGRPKPPPSLMLSHFSDVKERAHNLNKDIRKGKFQTYCLSEWPIFDEGTFHLPIILQVKA
IIFKDKPDGHPDQVPYILVWQDMIENPPSWLKPFFPPKVGPTKILVLWKAEKETETKAKT
PLYPVLQDSSPEDLIHLLPYQAPPPPSAPPLEAPGAAGVAPPLPDEGIPVRGPAAGTHGQ
THWAAPPSNMGPANSTALPLHAMGPDSHESGEQPMLYWPFSTSDLYNWRTQNAKFSDNPK
DLIGLLDTVLFTHQPTWDDCQQLLQVLFTTEEREQLQVEARKSVLGEDRQPTQNPDLISA
SFPLSRPTWDYNSAEGKERYMAKVYDVRQGKDESPASFLETEAFRQYTPMNPEAPETKAA
IIMAFVNQAAPDIKRKLQRVERLGEKSLQDLIIVAERVY
Download sequence
Identical sequences ENSFCAP00000020388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]