SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020416 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020416
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.27e-16
Family THAP domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000020416
Domain Number - Region: 104-172
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.012
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020416   Gene: ENSFCAG00000012850   Transcript: ENSFCAT00000012854
Sequence length 307
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:45492005:45492928:1 gene:ENSFCAG00000012850 transcript:ENSFCAT00000012854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRL
CSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQP
PPQQQSSPSASTAQASQLQPNLVSASAAVLLTLQAAVDSSQAPGSVPPAPTTPTGEDVKP
IDLTVQVEFAAAEGAAAAAAASELEAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHSYS
LSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMAV
IRKKHGM
Download sequence
Identical sequences M3X1C3
ENSFCAP00000020416 XP_003998187.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]