SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020620 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020620
Domain Number 1 Region: 66-367
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-79
Family Protein kinases, catalytic subunit 0.0000000000274
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000020620
Domain Number - Region: 24-76
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0242
Family Spectrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020620   Gene: ENSFCAG00000028389   Transcript: ENSFCAT00000032101
Sequence length 396
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:40800579:40845776:-1 gene:ENSFCAG00000028389 transcript:ENSFCAT00000032101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRERKPEGGTVPLQPCLFWVPTPPDRGRDRTNLEALQKKLEELELDEQQRKRLEAFLTQK
QKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQV
LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGL
TYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQG
THYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPL
SSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMV
HAFIKRSDGEEVDFAGWLCSTIGLNQPSTPTHAAGV
Download sequence
Identical sequences ENSFCAP00000020620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]