SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020807 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020807
Domain Number 1 Region: 259-323
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000622
Family LIM domain 0.058
Further Details:      
 
Domain Number 2 Region: 319-385
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000038
Family LIM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020807   Gene: ENSFCAG00000029911   Transcript: ENSFCAT00000029196
Sequence length 412
Comment pep:known chromosome:Felis_catus_6.2:A2:134665871:134705175:1 gene:ENSFCAG00000029911 transcript:ENSFCAT00000029196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFED
TKYTTLIAKLKTDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQM
LPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPKEVKEMEQFVKKYKSEALGV
GDVKLPREMDTQGPNRMLLPGGDRSTTAAVGAMEGKSAEHKRTQYSCYCCKLSMKEGDPA
IYAERAGYDKLWHPACFVCSACQELLVDMIYFWKNGKLYCGRHYCDSEKPRCAGCDELIF
SNEYTQAENQNWHLKHFCCFDCDNILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAID
PEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKMMS
Download sequence
Identical sequences ENSFCAP00000020807 XP_014922825.1.86478 XP_019670159.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]