SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020831 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020831
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Spectrin repeat 5.61e-17
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 71-168
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000317
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000020831
Domain Number - Region: 229-310
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0157
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020831   Gene: ENSFCAG00000027623   Transcript: ENSFCAT00000029414
Sequence length 339
Comment pep:novel scaffold:Felis_catus_6.2:JH408995.1:1278:4123:1 gene:ENSFCAG00000027623 transcript:ENSFCAT00000029414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLSEKEEEEVGFDWGEHNSNMAAKKESYSALMRELELKEKKVKEIQSTGDRLLREGHPA
RPTVESFQAALQTQWSWMLQLCCCIEAHLKENTAYFQFFSDVRDTEEQLRKLQETLRRKY
TCDRSITVTRLEDLLQDAQDEKDQLGEYRAHLSGLAKRAKAIVQLKPRSQAHPVRGRVPL
LAVCDYKQVEVTVHKGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAV
TRLDAQLQALVTLWHQLHVDLKSLLAWQNLSRDVQLIRSWSLVTFRTLKPEEQRQALRSL
ELHYQAFLRDSQDAGGXXXXXXXALHLRAQGHPAAARGL
Download sequence
Identical sequences ENSFCAP00000020831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]