SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020872 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020872
Domain Number 1 Region: 28-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000234
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020872   Gene: ENSFCAG00000005095   Transcript: ENSFCAT00000025562
Sequence length 148
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:47831758:47846245:-1 gene:ENSFCAG00000005095 transcript:ENSFCAT00000025562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNGLFNFAGADNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFK
CNGEWVHQNEHVSEESLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSK
SRKASVRIASSMFSSSQTDLEGQKLPSS
Download sequence
Identical sequences ENSFCAP00000020872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]