SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020942 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020942
Domain Number 1 Region: 268-358
Classification Level Classification E-value
Superfamily Fibronectin type III 3.45e-17
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 2 Region: 132-217
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000452
Family Ankyrin repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020942   Gene: ENSFCAG00000001897   Transcript: ENSFCAT00000029802
Sequence length 763
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:32262220:32530094:-1 gene:ENSFCAG00000001897 transcript:ENSFCAT00000029802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASLTRRLPFKDRHFTCSKIIGRRFACFAQRLSHRRKQSQCDLLNESTGQLPTTCSSAA
SNNLNWNCFVKMTQQMQNLHLSQSKKHSAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFR
TRTDRLSLRKTSVNFQGNEAMFEAVEQQDMDAVQILLYQYTPEELDLNTPNSEGLTPLDI
AIMTNNVPIARILLRTGARESPHFVSLESRAMHLATLVQEAQQRVSELSAQVENEGPSLD
NTEKEKQLKAWEWRCRLYRRMRTGFEHARAPEVPTNASLMVTSSTSLTVSFQEPLSVNAA
VVTRYKVEWSMSKDFRPLAGEIIMENLQTLRCTITGLTTGQQYFVQVSAYNMKGWGPAQT
TTPACASPSNWKDYDDREPRHKGQSEVLEGLLQQVRALHQHYSCRETSKLQTTGRKQSVS
RSLKHLFHSSNKFVKTLKRGLYIAVIFYYKDNMLVTNEDQIPIVEIDDSHTSSITQDFLW
FTKLSCMWEDIRWLRQSVPISMSSSTVLQARQKMLAATAQLQNLLGTHNLGRVYYEPIKD
RHGNILIVTIREVETLYSFFNGKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILSYH
KRSHQRLSPGLYLGYLKLCSSVDQIKVLVTQKLPNILCHVKIRENNNISKEEWEWVQKLS
GSESMESVDHTSDCPMQLFFYELQMAVKALLKQINIPLHQARNFRLYTQEVLEMGHNVSF
LLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT
Download sequence
Identical sequences ENSFCAP00000020942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]