SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000021004 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000021004
Domain Number 1 Region: 34-275
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-73
Family Calponin-homology domain, CH-domain 0.000021
Further Details:      
 
Domain Number 2 Region: 295-414
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-28
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 1262-1416
Classification Level Classification E-value
Superfamily Spectrin repeat 6.79e-28
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 4 Region: 2738-2889
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-25
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 5 Region: 2314-2467
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-25
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 2524-2679
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-25
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 640-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-21
Family Spectrin repeat 0.00072
Further Details:      
 
Domain Number 8 Region: 1488-1615
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-21
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 9 Region: 2118-2252
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-21
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 1574-1708
Classification Level Classification E-value
Superfamily Spectrin repeat 9.16e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 11 Region: 2894-2995
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-20
Family Spectrin repeat 0.00048
Further Details:      
 
Domain Number 12 Region: 1697-1835
Classification Level Classification E-value
Superfamily Spectrin repeat 6e-20
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 13 Region: 3282-3420
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 14 Region: 3159-3314
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 15 Region: 860-996
Classification Level Classification E-value
Superfamily Spectrin repeat 1.26e-17
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 16 Region: 2968-3097
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-16
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 17 Region: 1105-1206
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000144
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 18 Region: 1832-1947
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000173
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 19 Region: 746-808,854-895
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000301
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 20 Region: 1938-2052
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000018
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 21 Region: 413-526
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000432
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 22 Region: 537-636
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000144
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 23 Region: 2052-2146
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000662
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 24 Region: 3423-3484
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000072
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 25 Region: 1387-1484
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000273
Family Spectrin repeat 0.006
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000021004
Domain Number - Region: 3524-3641
Classification Level Classification E-value
Superfamily PH domain-like 0.000188
Family Pleckstrin-homology domain (PH domain) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000021004   Gene: ENSFCAG00000028031   Transcript: ENSFCAT00000024955
Sequence length 3648
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:63180782:63225155:1 gene:ENSFCAG00000028031 transcript:ENSFCAT00000024955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGQPHSPQQLLGATGCLKQGTSHRAPPCPTMDSAYEMSHIRKLQAQHMRMQEKTFTNWI
NNIFQHGRVGIKIQNLYTELADGTHLLRLLELISGEALPPPSRGRMRVHFLENSSRALAF
LRAKVPIPLIGPENIVDGDQTLILGLIWVIILRFQISQICLDREEFGASAALLSAKEALL
VWCQRKTACYANVNITDFSRSWSDGLGFSALIHAHRPDLLDYCSLRSERPLHNLDLAFRV
AEQELGIAQLLDPEDVAALQPDERSIMTYVSLYYHHFSRLHHEQTVQRRLAKILLQLQET
EELQTQYEQLVADLLRWIAEKQVQLEARDFPDSLPAMRQLLVAFAFFRTQEKPPRLQQRG
ATEALLFRLQTALRAQNRRLFLPHEGLGPAELSQRWAVLERAEASRSQALLRRILQLERL
ETLARRFQRKAALRENFLTDTEQMLDKATAATPPASLATVDAAAQRLGMLEASILPQEGR
FQALAEIADILQQEQHHGWADVARRQLEITGRWEQLLRRLQGQKKQMAGLQVVLSLLQEV
ETASNQLKELQVLASSTACGQQLAETVELLQKHDLLEAQVSAHGAHVRHLGLQTSQLDSS
LGTTVEVLQAKAQALAQLHGSLVSLLRARRTLLEQTLQQAEFLHNCEEEETWLREHEQLV
EDEALGRDLSQIRAALQKHKALEAELRHHQAVCTDLVRRGCDLGARGHPTRPDPWERAQA
LQGAWQRLRASTARRGARLQAAMLVQEYFSDAADAASWLREQHSALESASRGRDQTAAEA
LLLRHQRLERSLHAFGMELRRLDEQARAAATQVSLTVPQVVSALSSPKEGPRNLRTRSEV
SCHSGPPSTQKMVLSAELDPDFDPNTILQTQDCLNQDYEGLGALAKHRRAQLEEAVALFG
FYDSCGELQSRLENQTALLQMLQPQADDLEATRLKYKNFLTALAVGRGCLTEVSSSAEQL
KQRCPEDAPRIQQQQEELSQRWGQLEALKKEKEMQLARTTDVCSFLHKCRSTQVQLRDLI
LRLETLELGQSEDSHCVLQLAQQKMPALERSVYHLQRITIKAEEAGPTENQCLRGQVETL
QGLLEQVQQHVARQARAQAEARTRQSFLQDSQQLLLWAEGVWARLHSEEKAVDVASAQRL
LMEHGDLLEEIRLQQERLQQLEAQGQPIAASDSPDSQEVARVLRLLSQRGWGLQAAWEQR
RQQLQEGLELHRFGRDVDDFTATCASHEAFLRQGHLGEDVGEAQSLLQQHQEFGHLLGIL
GPRVEALRARGEKLAQSRHPAARKVREQLQSIQGRWTGVQEKSEQRKRQLLASLQLQEWK
QDVAELMLWIEEKGLMAAHGPSREPSNLLQQLKLHRAAERALLATYGHMEALQQVGRQLL
SSRLHAQEDVQGSLQGLSNKWEELKHKMAERGDQLQKARQQAQLLRLLQDAQEKMEQLEG
TLQSAEPGQDLGSSRRRQKQHCQLESESQALASKMAALVAQAERGLTSQTVTEETQKYLQ
RFESLQEHLATRHVQLQASLELYRFYQLSDLELTWVAEHMPRASSTSSAGCLNGAQRLCH
KHEVLQAEVKAHQGQVQWVLGSGRSLAASGHPQAQRVMEQCQKLEGLWAELERTCEVQAQ
CLQQAVAVQQYFLAASELEDCVKEKWPLVSSQDYGGDKAATARLIGKHQALQQELVLYWS
SMEKLDQQAHTLTGPGAPEQLEVVRERLREQLQELQALAITRGRELEGTLKLHEFMGEAE
ELWSWLASQKQVAREGESLGEDHEHVLHLRTKFAKLQRQVELGGQRVATCQQLVESLLEL
GHRAAPDAHQRQQDLQASWSELRELTQAQGHRLQDAEVTLRVHRDLSEALRQVQEKTTSL
PNDVASDLRGLEAQLRRHEELEHELLGTGRQLQELLETAIRVQKLGRGPQAHAVQQRQQA
LVKAWEALKLHTEQRRTQLERACLLARFHRSVREYTSWAARVWQELQGEESSREPSSGLL
KLVAHQQLRAELEARAELHQRASELGQQVLLAAGTPIKEVQEMLQGLQDEREQMFQAWEQ
KEKKLQAMYQEQIFLRKCTLLDQILTAQEVSLKTSALGSSVEEVEQLVRKHKTFQKVLTA
QDEQEAALSEQAKTLGGPKVQDGLRTVLEHRARVKDLAESRGRALHTSLLLTGFTTAVTQ
AQVWIQERVQQLKEPIRPGDLKDNLRHLRKLQAFEAEVQAHEEVIISVTKDGEALVAQSH
PQVGEVSQRLRVLQEHWQKLRQAVALRGQDLENKRNFLEFLQKADLADAWIQETEAMVDT
GDLGRDLEHCLQLRKQLRKLRGVWAQDTVDDTHIRSINDLSRKLQNLCPEQVKTVCQRRH
QLNNRWESFHDNLLRYQQQLEGALETHTLSGKLDDLTERIGEKAALVQALDCGKDPESVQ
RLIRKHKELEQEMGLIQAQVESLECEVGRLCQRSPGAAHSLSHKQREMTDSWWQLRSEAQ
KRKESLDALHQAQKLQAALQHLLVWARRLRAEMDAQSPPRPAEARRLIVGHWELKAELDS
QRDSISLARSTGQRLLADGHPSTPDILQALAGLDQELNTLERAWQGHQHRLQQALELQLV
LSSMEQVESWLCSREDCPASEGLGDPSANVETLLWKHKVLERGLEAQAEKISALEVAAHS
LQRGGHPEAQRALGQCQALLLRKEALIERAASRRRQLEELRQLQTFLQDSLEVATWLREK
DSVALDEGWRNPALLQTQLWKQKSLQAELDASVHHQQRLQAEGQRLLQEGHPASETIRER
LQELGELWDRLQANSRRKAATLQEACEALRLRRSVEELESWLEPVEVTLRAPIPGRDQPG
LDELLGAQGGLEAAVDRQAGQVQLLLGQAQVLTREGHCLAPDLEDRAQKLLRRFESLQEP
LRERREALEARSRLSQFFRDAEEEMAWVQERLPLAATQDCGQSLSAVRHLQEKHQNLESE
ISSHEALTQAVVDAGHKLVRAGHSACDVAVRVQQLENAMGSLRAQVTQRRLLLQQTQEAQ
QFLTELQEAESWLEEQGRVLDIEDVGQSAEATRAFLRQLEATTRDLEGFSMRIERLQQTA
ALLESRQNPESPRVLARMRAAREAHSGLLQRAEGRRQGLQEQLQLHQLEREALLLDAWLA
SKVATAESQDHGQDLEAAKVLEEKFDAFRKEVQSLGQAKVQALRELAGSLERTARRHKPQ
IQAQRSRIEATWERLDRAMKARTQSLATACEVLGFEQEVAQLQGWMQEKVTLMARDICGR
SLSSVQTLQQQHRCLERELAAMEKEVARMRMEACRLGQLHPVVRGGLSEQLAKMEDAWAA
LDVKAQEQGQQLEQAARGHAFLGRCRELLAWAQEKQVLASSQELAGDLVGAEQLLVQQEE
LGQEIKEYCLRAQDVRQEGQQLVDSGHFMSPEVTGCLRELEGQLQALAEACALRQERCEE
NWGLQKLRQELDQAEAWLASREGLLLDPNCGHSVADVELLLHGHHDLEKSLAAQQEKFAQ
LQRETGVEQKLLQQGTGLKARSAGHQFTFLQHRPLGSWGPVQLAETRDLQDAKGAPTMEG
FLELKQQWPAERQPSSSPWDCCCGTLGGSSLSLFWDKKTAAENVAPMDTLDLTGAQCERL
RGRVVTHGSLPSRLSSGVEILYAAPSEQHAWSWHRALSGTAGVCLTPK
Download sequence
Identical sequences ENSFCAP00000021004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]