SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000021252 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000021252
Domain Number 1 Region: 326-459
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.23e-35
Family PLC-like (P variant) 0.0026
Further Details:      
 
Domain Number 2 Region: 147-313
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.000000000000498
Family Dual specificity phosphatase-like 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000021252
Domain Number - Region: 13-141
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000942
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000021252   Gene: ENSFCAG00000028931   Transcript: ENSFCAT00000029472
Sequence length 460
Comment pep:novel chromosome:Felis_catus_6.2:A1:18845962:18932769:-1 gene:ENSFCAG00000028931 transcript:ENSFCAT00000029472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FILFICCRIFGILLIFVDLSLVITDLLVTKNAIYIPMEIHLISLAISLFFVLDVLLRVYV
EGIRLYFSGILNCLDAVIIVVTLLVDIIYMFYDLKVLKDIPRLAILFQSLRLIILIRVFH
LAHQKKHLEMLTRRLVSENKRRYKKDGFDLDLTYVTERIIAMSFPSSGQQSFYRNPIKKD
GNSLDKIHIENYEEISNFCKVKRYYSPQFLSFFIVLLLYRDMHIPSVDEMLTHNVCVCMW
LCFVWANFLTMSCKSSKRRTGTMACACLIASEIFTTAEDSLYYFGERRTDKSTSTKYQGV
ETPSQSRYVGYFADVKNIYNLNLPARKTLKIKKIVIYSIHGVGKGNGNDLKVQIILHRKI
VFLSSASKNCWILHDIETDNVIIHLSSCPPLYDDVKVRFLSSSVLPKYYDNCPFFFWFHT
SFIQNNRLYLSRNELDNPHKPKTWKIYRPEFAVEVFFDEV
Download sequence
Identical sequences ENSFCAP00000021252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]