SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000021289 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000021289
Domain Number 1 Region: 586-820
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.36e-83
Family Eukaryotic proteases 0.0000000193
Further Details:      
 
Domain Number 2 Region: 375-472
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-39
Family Kringle modules 0.0000156
Further Details:      
 
Domain Number 3 Region: 96-190
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-37
Family Kringle modules 0.0000248
Further Details:      
 
Domain Number 4 Region: 279-365
Classification Level Classification E-value
Superfamily Kringle-like 1.45e-36
Family Kringle modules 0.0000152
Further Details:      
 
Domain Number 5 Region: 190-274
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-35
Family Kringle modules 0.0000108
Further Details:      
 
Domain Number 6 Region: 473-572
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-34
Family Kringle modules 0.0000105
Further Details:      
 
Domain Number 7 Region: 26-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.84e-21
Family Hairpin loop containing domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000021289   Gene: ENSFCAG00000023975   Transcript: ENSFCAT00000025746
Sequence length 821
Comment pep:novel chromosome:Felis_catus_6.2:B2:146361166:146404452:-1 gene:ENSFCAG00000023975 transcript:ENSFCAT00000025746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLAGPKMEHKEVILLLLLFLKSGHGDPLDDYVNTQGASLVSLTKKQLSAGSIEECAARC
EEETGFICRSFQYHSKEQHCVIMAENSKNSAVFRMRDVVLFEKKIYLSECKIGNGKSYRG
TMSKTKNGVTCQKWSDNAPHKPNYSPDKYPAEGLEENYCRNPDSDEDGPWCYTTDPNKRF
DYCDIPECEDECMHCSGENYEGKISKTISGIKCQSWNSQTPHAHGYIPSKFPNKNLKMNY
CRNPDGEPRPWCFTTDPNKRWEFCDIPRCTTPPPTPGPTYECLKGKGENYRGKVSLTVSG
HTCQRWSEQTPHKHNRTPENFPCKNLDENYCRNPDGETTPWCYTTNSEVRWEYCQIPSCE
SSPLSSEHLDAPVSVPPEQTPVVQECYRGNGQSYRGTSSTTITGKKCQPWSSMVPHRHVK
TPERYPDAGLTMNYCRNPDADKSPWCYTTDPSVRWEFCNLKKCPDREESATKSPTVSQVP
SAEDPSESDCMFGNGKGYRGKRATTVSGIPCQEWGAQEPHRHGIFTPVTNPQSGLEKNYC
RNPDGDVNGPWCYTMSPRKLFDYCDVPQCASASFDCGKPQVEPKKCPGRVVGGCVANPHS
WPWQVSLRTRFGQHFCGGTLIAPEWVLTAAHCLERSSRPAAYKVILGAHRELNLETDVQD
IEVSKLFLEPTRADIALLKLSRSAVITSKVIPACLPPPNYVVADRTLCYITGWGDTQDTG
TFGAGLLKEAQLPVIENKVCNRYEYLNGRVKSTELCAGNLAGGTDSCQGDSGGPLVCFEK
DKYILQGVTSWGLGCARPNKPGVYVRVSRFVPWIEGIMRNN
Download sequence
Identical sequences ENSFCAP00000021289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]