SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000021331 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000021331
Domain Number 1 Region: 100-162
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.01e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 281-344
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.33e-16
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 223-284
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.82e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 187-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000387
Family LIM domain 0.00044
Further Details:      
 
Domain Number 5 Region: 63-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000627
Family LIM domain 0.0011
Further Details:      
 
Domain Number 6 Region: 158-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000101
Family LIM domain 0.0009
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000021331
Domain Number - Region: 340-369
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0189
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000021331   Gene: ENSFCAG00000027363   Transcript: ENSFCAT00000028246
Sequence length 387
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:54483263:54515292:-1 gene:ENSFCAG00000027363 transcript:ENSFCAT00000028246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFPGRVCPYVIPENEEIPQTALNNVHQANGNEDERAVSKLQRRHSDVKVYKEFCDFYAK
FNMANALANATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKY
CEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLC
RPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGE
LYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLA
YCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKP
VCKKCYEKFPLELKKRLKKLAETLGRK
Download sequence
Identical sequences M3X3Y1
ENSFCAP00000021331 XP_003983910.1.62641 XP_007097815.1.5354 XP_014930271.1.86478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]