SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000021596 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000021596
Domain Number 1 Region: 1103-1182
Classification Level Classification E-value
Superfamily HMG-box 1.17e-22
Family HMG-box 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000021596
Domain Number - Region: 2142-2251
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0837
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000021596   Gene: ENSFCAG00000012737   Transcript: ENSFCAT00000024925
Sequence length 2520
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:12682753:12709108:1 gene:ENSFCAG00000012737 transcript:ENSFCAT00000024925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPMKKACAGLPGSGSGGKSPPATRAKALRRRGAGEGDKPEEEDDEAQQQQQQPPGPEEA
EEGEEEESERGPGAEGLLPELHPDDSAAPGPAEDPKVEGEASRWEPSLSRKTATFKSRAP
KKKYVEEHGAGSGSIGAAGAPEERARTPEEAGTLGVPPRPPTSTRSSSTDTASEHSADLE
DEPAEACGPGPWPPSGTSGGYDLRQLRSQRVLARRGDGLFLPAVVRQVRRSQDLGVQFPG
DRALTFYEGAPGGGVDVVLDATPPPGALAVGTAVCTCVEPGVAAYREGVVVEVATKPASY
KVRLSPGPNSQPGPPATLPQPPQLPHREPEEAVWVARSSLRLLRPPWEPEALPRKPPAGP
EEEQAEPGGTLPPCPAALDPKQPEDAEVSKISFGGNLGACEEGEEKHPPALGTPALLPLP
PPQLLSPPPKSPAFAGPGRPGEQPSPCQEGSQGGSRSSSVASLEKGAAPAARARTPLTAA
QQKYKKGDVVCTPNGIRKKFNGKQWRRLCSRDGCMKESQRRGYCSRHLSMRTKEMEGLAD
SGPGGAGRPAGVAAREGSTEFDWGDETSRDSEASSVAARGDSRPRLVAPADLSRFEFDEC
EAAVMLVSLGSSRSGTPSFSPVSTQSPFSPAPSPSPSPLFGFRPANFSPINASPVIQRTA
VRSRHLSASTPKAGVLTPPDLGPHPPPPAPRERHSSGILPTFQTNLTFTVPISPGRRKTE
LLPHPGALGAPGAGGGGATPDFPKSDNLDSGVDSVSHTPTPSTPAGFRAVSPAVPFSRSR
QPSPLLLLPPPAGLTSDPGPSVRRVPAVQRDSPVIVRNPDVPLPSKFPGEVGTAGEARAA
GPGRGCRETPVPPGVASGKPGLPPPLPAPVPITVPPAAPTAVAQPMPTFGLASSPFQPVA
FHPSPAALLPVLVPSSYTSHPAPKKEVIMGRPGTVWTNVEPRSVAVFPWHSLVPFLAPSQ
PDPSVQPSEAQQPASHPVASNQSKEPAESAAVAHEQPPGGTGNADPGRPPGATCPESPGP
GPPHTLGVVEPGKGPPPTTEEEAPGPPGEPRLDSETESDHDDAFLSIMSPEIQLPLPPGK
RRTQSLSALPKERDSSSEKDGRSPNKREKDHIRRPMNAFMIFSKRHRALVHQRHPNQDNR
TVSKILGEWWYALGPKEKQKYHDLAFQVKEAHFKAHPDWKWCNKDRKKSSSEAKPTSLGL
AGGHKETRERSMSETGTAAAPGVSSELLSVAAQTLLSSDTKAPGSGSCGAERLHTVGGPG
SARPRAFSHSGVHSLDGGEVDSQALQELTQMVSGPASYSGTKPSTQYGTPGPFSASGEGG
ALAASGRPSLLPTRASRSQRAASEDMTSDEERMVICEEEGDDDVIADDGFGTTDIDLKCK
ERVTDSESGDSSGEDPEGSKGFGRKVFSPVIRSSFTHCRPSLDPEPPGPPDPPAAFGKGY
GPTPSSSSSSPASSSASAATSFPLGSGTFKAQESGQGSTAGPLRPPLPGAGGPVTPSKAT
RFLSTDPATFRRKRPESVGGLEPPGPSVIAAPPGGGGSVLQTLVLPPNKEEREGSGARMP
SAPAPSLAYGAPAAPLSRPAATMVTNVVRPVSSTPVPIASKPFPTSGRAEASPSDTAGAR
TEPVAGSRAPGSSPLGVSLVYSDKKSAAATSPAPHLVAGPLLGTVGKAPATVTNLLVGTP
GYGAPAPPAVQFIAQGAPGSGAATGSGAGAGSGPNGPVPLGILQPGALGKAGGITQVQYI
LPTLPQQLQVAPAPAPAPGTKAAAPGGPAPTTSIRFTLPPGTSTNGKVLAATAPTPGIPI
LQSVPSAPPPKAQSVSPVQAPPPGGSAQLLPGKVLVPLAAPSMSVRGGGAGQPLPLVSPP
FSVPVQNGAQPPSKIIQLTPVPVSTPSGLVPPLSPATLSGPTSQPQKVLLPSSTRITYVQ
SAGGHALPLGTSPTSSQAGTVTSYGPTSSVALGFTSLGPSGPAFVQPLLSGQAPLLAPGQ
VGVSPVPSPQLPPTCTAPGGPVITAFYPGSPAPTSSAPLAQPSQAPPGLVYTVATSTTPP
AATILPKGPPAPATATPAPTSPFPNATGSMTYSLVAPKAQRPTPKAPQKVKAAIASIPVG
SFEAGAPGRSGPASRQPLEPGPAREPPVPESELEGQPTTPAPPPPPETWAPTARSSPPPP
PPAEERTGTKGPETMASKFPSSSSDWRVPGLGLESRGEPPTPPSPAPAPAPAPSSSSSSS
EGSSGRAAGDTPERKEAAGTGKKVKVRPPPLKKTFDSVDKVLSEVDFEERFAELPEFRPE
EVLPSPTLQSLATSPRAILGSYRKKRKNSTDLDSAPEDPTSPKRKMRRRSSCSSEPNTPK
SAKCEGDIFTFDRTGTEAEDVLGELEYEKVPYSSLRRTLDQRRALVMQLFQDHGFFPSAQ
ATAAFQARYADIFPSKVCLQLKIREVRQKIMQAATPTEQPPGAEAPLPGPPPTGTAAAPV
PTPSPAGGPDPTSPGSDSGTASAAPPLPPPPEPGPGQPGWEGPPQPSPPPPGPSTAATGR
Download sequence
Identical sequences M3X4P6
ENSFCAP00000021596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]