SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000021777 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000021777
Domain Number 1 Region: 346-469
Classification Level Classification E-value
Superfamily EF-hand 1.46e-53
Family EF-hand modules in multidomain proteins 0.000000579
Further Details:      
 
Domain Number 2 Region: 471-567
Classification Level Classification E-value
Superfamily EF-hand 1.33e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 3 Region: 547-635
Classification Level Classification E-value
Superfamily RING/U-box 6.24e-22
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 4 Region: 12-139
Classification Level Classification E-value
Superfamily Spectrin repeat 1.67e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 5 Region: 162-301
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-18
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 6 Region: 308-345
Classification Level Classification E-value
Superfamily WW domain 0.00000000000742
Family WW domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000021777   Gene: ENSFCAG00000022242   Transcript: ENSFCAT00000029375
Sequence length 964
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:26225440:26595797:-1 gene:ENSFCAG00000022242 transcript:ENSFCAT00000029375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLQGEIEAHTDIYHNLDENGQKVLRSLEGSDDAALLQRRLDTMNFKWRELRKKSLNIRSH
LEASSDQWKRLHLSLQELLVWLQLKDDELSRQAPMGGDFPAVQKQNDVHRAFKRELKTKE
PVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLN
LHSADWQRKIDEALERLQELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVK
VLRGEITPLKENVSYVNDLARQLTTLGIQLSPYNLNTLEDLNTRWKLLQVAVEDRIRQLH
EAHRDFGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLN
NVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQVINCLTTIYD
RLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLF
KQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAA
LFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQS
CFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQT
VLEGDNMETPVTLINFWPVDSAPASSPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSI
SPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESEERGELERILADLEEENRN
LQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQIL
EDHNKQLESQLQRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSES
MGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGHNVGSLFHLADDLGRAMESLVSVMTDE
EGAE
Download sequence
Identical sequences ENSFCAP00000021777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]