SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000021811 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000021811
Domain Number 1 Region: 216-343
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 357-449
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-25
Family Third domain of FERM 0.0032
Further Details:      
 
Domain Number 3 Region: 2-78
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000103
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 127-178
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000827
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000021811   Gene: ENSFCAG00000024792   Transcript: ENSFCAT00000027502
Sequence length 450
Comment pep:novel chromosome:Felis_catus_6.2:X:86859685:86905885:1 gene:ENSFCAG00000024792 transcript:ENSFCAT00000027502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQVTIHRDPIYGFGFVAGSERPVVVRSVRPGGPSEDKLLAGDQIVAINEEDVSEAPRERF
IELIRSAKEFIVLTVLHTHQSPKSAFISAAKKARLRSNPVKVRFSEQVAVGETDAKMMKK
EALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVIVTLQDRLSLRYIEHFALVLEYAGPEQ
NHKFLLLQDKQPLAYVVQRTHYQGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQSRNDV
IRERFGMDPKPEMLLGLAALHIYITVSATRPSQKISLKNVEKEWGLEPFLPPSLLQGIKE
KNLRKSLSQQLKAHQTHPSSGTKGSAIQAKLQYLRILNELPTFTGVLFNTVGLVSEDEKQ
SATTLLVGPRHGISHVIDLKTNLTTVLSEFSKISKIQLFRENQGVARVETSIMDAKPLVL
LMEWPEATNFACLIAGYCRLLLDSRKMVFS
Download sequence
Identical sequences ENSFCAP00000021811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]