SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000021859 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000021859
Domain Number 1 Region: 934-1075
Classification Level Classification E-value
Superfamily TNF-like 2.27e-24
Family TNF-like 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000021859
Domain Number - Region: 646-725
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0082
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 452-505
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0981
Family Fibrinogen coiled-coil and central regions 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000021859   Gene: ENSFCAG00000027624   Transcript: ENSFCAT00000030889
Sequence length 1080
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:42435929:42486056:-1 gene:ENSFCAG00000027624 transcript:ENSFCAT00000030889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTRGLPDSPTAATSPGAGARLLEGGRRSCSASGPQPMHPARPGARNKNWCAYIVNKNVSC
SVLEGSESFIQAQYNCPWNQMPCPSALVYRVNFRPRYVTKYKTVTQLEWRCCPGFRGGDC
QEGPRDPVKTPRPTPARPRNSVKKATDNEPSQVSEPKKILPPTRATEPSQVIDPKEGAQE
LQEKKIQVLEEKVLRLTRTVLDLQSSIAGVNENLKHAVQDDASKMLASWLSNLHPQPVPD
SAIGGDTETVQLPDVLNNKESGMKDIKSELAEVKDALKTKSDKLEELDGKVKGYEGQLKQ
LQEAAQGPTVTMTTNELYQAYVDSKIDALREELMEGMDRKLADLKNSCEYKLIGLQQQCD
DYGSSYLGVIELIGEKETNLRKEINDLRDRVQDPSARSNCCNSEKNGDFGPQIKMLDQKI
ERVAEATRMLNARLDNEFDRLVVPEPDVDFDARWNELDARINVTERNAEEHCFYIEETLR
GTINGEVDDLKQLLDQKIQSLEERLGSVLLEVANSTDAELIPPASALPGVSGAGSKQVMI
ELNHLKSKVQVVEDICLQNFQGEPHGIEDTLPNGEEHIAGDSLNLLKSLNDTMHRKFQET
ERSIQKLQQDFSLYSQLNHTEDDVNHLQKELSSXSKGGEKERTVEPLPSPQDPMAHCCSH
LEERWQRLQSQVLSELDTCKENTHGVQRDVSVVESRVSHMEKACSKLDSISGSLQRIKEG
LNKHVNSLWSCVRQMNGTLRSHSRDISGLKNSVQQFYSHVFQISTDLQDLIKFQPSATEE
PSEAPQPPPRGKAPQVPGRPSHPGPVEAPTEASHPKPTPLPRPSAPPLPEEPGKRLPTGQ
QPVLPKRPLQPLPPPAWPRWTGLPFLPGSTGVIMETGEAGPPGRMGVSGRGLPQGVDGQT
GQGPIPSAEGFAGAPGYPSSPPVASPGTPAPSLVSFSAGLTQKPFPSDGGVVLFNKVLVN
DGDVYNPDTGIFTAPYDGRYLITATLTPERDAYVEAVLSVSNASVAQLHTAGYKREFLEY
HRPQGALHTCGGPGAFHLIVHLKAGDGVNIVTGGRLAHTDFDEMYSTFSGVFLYPFLSHL
Download sequence
Identical sequences ENSFCAP00000021859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]