SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000021891 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000021891
Domain Number 1 Region: 73-268
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.86e-30
Family Reprolysin-like 0.0069
Further Details:      
 
Domain Number 2 Region: 378-434
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000111
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 3 Region: 1058-1121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 1010-1063
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 
Domain Number 5 Region: 939-1003
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000994
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 6 Region: 1172-1260
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000113
Family Spermadhesin, CUB domain 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000021891
Domain Number - Region: 1282-1388
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000458
Family Spermadhesin, CUB domain 0.02
Further Details:      
 
Domain Number - Region: 678-738
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00615
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number - Region: 893-942
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0379
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000021891   Gene: ENSFCAG00000026549   Transcript: ENSFCAT00000026032
Sequence length 1406
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:93974506:94004633:-1 gene:ENSFCAG00000026549 transcript:ENSFCAT00000026032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREPRPWGRCVGATLTSAFFLLGCWGRSDFQQQFLQALEPEEVTSYFGPDATLEGRPPSP
RLRLRRWAAGRVLHLELLVAVGPDVYQAHQEDTERYVLTNLNMGSELLRDPSLGTQFQVH
LVKMVTLTQPEDAPNITANITASLLSVCEWSRTVNPEDDTDPGHADLVLYITRFDLELPD
GNRQVRGVTQLGGVCSSSWSCLITEDTGFDLGVTIAHEIGHSLRRETTARPGSGCGPSGH
VASQDAATARGDLSWSACSRQQLLHLLSPLFNPYRALSPPPLRGPPASSLAPPSSHPSLR
GSCFSPTPTXFGPAAVACTFARGHLDVCQALSCHEDPLDQSVCSRLLTPLLDGTECGEQK
WCSKGHCRSLAELTPVGVVHGHWSSWGPPSPCSRSCGGGVVTRRRQCSNPRPAFGGRACV
GDDLQAEMCNTQACEKTQLDFMSEQCSRTDRKPLHLSPGHASFYRWGSAEQYSQGDALCR
HMCRAIGETFIVRRGDSFLDGTRCVPSGRREDGTLSLCVSGSCRTFGCDGRMDSQQVRDA
CQVCGGDNSTCSPRNGSFTAGRAREYVTFLTVTRNLTSIYVTNQRPLFTHLAVRIGGRYI
VAGNSSISPSTTYPSLLEDSRVEYRVTLTEDRLPHLEEIRIRGPTREDVEIQVYRRYGEE
YGDLARPDITFTYFQPKQPQAWAWAAVRGPCSVSCGAGLRWVTYSCLDQARNEWVEAARC
EGSQRPAAWPESCAPGPCPPDWATGDLGAWERAVRFVEAQGSLPRTLPPARCQALALQPA
VLETRNPPAWPRQRPSWLKRQESDACSSACEAHLASHNGTCVHGAGGPDALATAGPCSTD
EKLPALEPCVATACPAAQGHVSALGYWRRRPHPHRPPARPGARAAHVWTPVAGPCSVSCS
RGLKELHFVCVDSVLGTPVQEELCDLGSKPGSRREVCQAAPCPAWWQYKLAACSVSCGGG
VAQRILYCARAHGRDEGEEILPDTQCLGLPRPEQQEPCGPEPCPPRWKIVSLGPCSASCG
LGTATRSVACVQFDQGQDVEVDGTACVALVRPQASIPCITADCAYRWHVSTWTQCSVSCG
DGIQHRHDACLGPGSRAPVPAHFCQHLPKPATVRGCWAGPCAGQGTPSPAPPEEATAGAP
PERPRSPTQRGKPRASLRATPRPEAPFCAPASFPGACGRQHLEPTGTIDMRGPGQADCVV
AIGRPLGEVVTVQVLESSLNCSTGDMLLLWSRFTWRKMCGKPSDMTFSSKGNTLLVRQRR
ERPEGGVVLRYRSQPAPGASHRECDMQLFGPWGKIVSPSMSPRGRNLGGCRIFINVAPRA
RIAIHALVTNVGTGTDASHILIRDIHSLKTMTFRGQQALYWESEGSQAEMEFSQGFMEAG
ASLWGLYWTLGSRVQEPGFWKGKKRT
Download sequence
Identical sequences ENSFCAP00000021891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]