SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000021903 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000021903
Domain Number 1 Region: 143-300
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.5e-27
Family Dual specificity phosphatase-like 0.0016
Further Details:      
 
Domain Number 2 Region: 2-150
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000000000123
Family Multidomain sulfurtransferase (rhodanese) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000021903   Gene: ENSFCAG00000028786   Transcript: ENSFCAT00000022573
Sequence length 311
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E3:9071971:9144498:1 gene:ENSFCAG00000028786 transcript:ENSFCAT00000022573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLVLCEPTELYNILNQVTKLSRLTEPNYLCLLDVRSKWEYDESHVITARRVEKKASEY
LLPESVDLECVRYCVVYDHNTSTLEIVLKEEEGDNCDDGPGLVPGAAVECGRALASLTRH
PVCILRGGYQGFSATYHFFRTQKIIWMPQELDAFQPYPVEIIPGRIYLGNFRQACDPKIQ
KDLKIKAHVNVSMEAGPFFVDDADSLLHIKIEDSPEANLSPFLRHLCHFLELHLQLGSVI
LVFSTLGISRSCAAILAFLMHWNEQTLKKSWAYVKKCKTNMHPNRGLVAQLSEWEKVVLG
DRVTDILDPLY
Download sequence
Identical sequences M3X5K2
XP_003998591.1.62641 XP_006942088.1.62641 XP_006942089.1.62641 ENSFCAP00000021903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]