SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022039 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022039
Domain Number 1 Region: 196-302
Classification Level Classification E-value
Superfamily Kringle-like 2.05e-31
Family Kringle modules 0.00055
Further Details:      
 
Domain Number 2 Region: 36-90
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-18
Family Fibronectin type II module 0.0032
Further Details:      
 
Domain Number 3 Region: 96-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000395
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000022039
Domain Number - Region: 423-467
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0201
Family PHD domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022039   Gene: ENSFCAG00000001538   Transcript: ENSFCAT00000022939
Sequence length 557
Comment pep:novel chromosome:Felis_catus_6.2:A1:173152216:173160124:1 gene:ENSFCAG00000001538 transcript:ENSFCAT00000022939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLFLGSLLGSLESAFLTPPWKAPKEHEHRADEHTVVLTVTGEPCYFPFQYNRQLYHT
CIHKGRPGRQPWCATSPNFEQDQQWAYCLEPKKVKDHCSKHSPCQNGGTCVNMPKGPHCI
CPEHFTGKHCQREKCFEPQLFQFFHEKETWHRLESAGVAECQCKGPDAHCKPLASQVCHT
NPCLNGGSCLEAEGHRLCRCRAGYAGRFCDVDTEARCYDGHGLDYRGTAETALSGARCQP
WASEATYRNVTAEQALNWGLGDHAFCRNPDNDTRPWCFVWSGDRLSWEYCRLARCEPPVL
EALQFLPPTQVPSEHPDFPLPSLSALQKPQPPTPALGATPEQPTPLPSPSCGQRLRKRLS
SLSRVVGGLVPARGAPLHRRYWRHNFCAGNLIASCWLAFPRIPSAHRPPPEELTVVLGQD
RHNQSCEQCQTLAVRAYCTRPSRPSPTSTTWPCCACRKERTATARSRRLSFSRCACQAAL
PAQLRPRPPSVRWQAGATSLRGPGNIPASCRKHRCRSSLLSAAPPRTCTESLLLRACSAL
ASLRVAPTPARVTPGAR
Download sequence
Identical sequences ENSFCAP00000022039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]