SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022186 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022186
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022186   Gene: ENSFCAG00000031565   Transcript: ENSFCAT00000024041
Sequence length 177
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:2211427:2225324:1 gene:ENSFCAG00000031565 transcript:ENSFCAT00000024041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDLVTFGDVAVDFSQEEWEWLNPAQRNLYRKVMLENYRSLVSLAGVSVSKPDVISLLE
QGKEPWMMKKEGTRGTYPDWEYAFKNNEFSSKQVIYEESSKVLTMGRSHLSYSLDCPSLR
EDCRCEDWFKNQLGSQEVHSRQLITTHEEILTEDKSNEYTKSWQTFHQDAIFDIKQN
Download sequence
Identical sequences ENSFCAP00000022186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]