SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022200 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022200
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.76e-30
Family Dual specificity phosphatase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022200   Gene: ENSFCAG00000022185   Transcript: ENSFCAT00000022311
Sequence length 141
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:101436824:101448520:1 gene:ENSFCAG00000022185 transcript:ENSFCAT00000022311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDENVRGVITMNEEYETRFLCNSSKEWKNVGVEQLRLSTVDMTGVPTLADLQKGVRFALK
YQSLGQCVYVHCKAGRSRSATMVAAYLIQVYNWSPEEAVRAITKIRSHIHIRSGQLEVLK
EFHKEITAGAAKEETYHTSQT
Download sequence
Identical sequences ENSFCAP00000022200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]