SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022290 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000022290
Domain Number - Region: 207-373
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0177
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022290   Gene: ENSFCAG00000029446   Transcript: ENSFCAT00000028302
Sequence length 453
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:7277325:7282743:-1 gene:ENSFCAG00000029446 transcript:ENSFCAT00000028302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGPGESPIGLLLSDPPTSLQTLFQSPEEGWQLYTSAQAPDGKCICTAVIPAQSTCSRDGR
SRELRQLMGKVQNVSQSMEVLELRTYRDLQYVRSMETLMRSLDARLRAADGSLSAKSFQE
LKDRMSELLPLSSVLEQYKADTRTIVRLREEVRNLSSSLAAIQEEMGAYGYEDLQRRVMA
LEARLHACAQKLGCGKLTGVSNPITVRAMGSRFGSWMTDTMAPSADSRVWYMDGYYKGRR
VLEFRTLGDFIKGQNFIQHLLPQPWAGTGHVVYNGSLFYNKYQSNVVVKYHFRSRSVLVQ
RSLPGAGYNNTFPYSWGGFSDMDFMVDESGLWAVYTTNQNAGNIVVSRLDPHTLEVVRSW
DTGYPKRSAGEAFMICGVLYVTNSHLAGAKVYFAYFTNTSSYEYTDVPFHNQYSHISMLD
YNPRERALYTWNNGHQVLYNVTLFHVISTAGDP
Download sequence
Identical sequences ENSFCAP00000022290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]