SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022335 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022335
Domain Number 1 Region: 10-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 102-163
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-17
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022335   Gene: ENSFCAG00000028829   Transcript: ENSFCAT00000032093
Sequence length 175
Comment pep:novel chromosome:Felis_catus_6.2:E2:15956527:16037478:-1 gene:ENSFCAG00000028829 transcript:ENSFCAT00000032093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVENPQGSCKGFVIFRDVSIDFSQEEWECLDSTQRNLYKYVMLENYSNLVSVGLCIPKP
DVISLLEQGKEPWSVFDSELTRDPYLEALYLSISFSHMAKGLVFKDVSIDLTQEEWECLD
FDQRDVYRNVILENYNNLISVAKLYTVSLSISKPDMVSILGQGKEPWMIGRKLTR
Download sequence
Identical sequences ENSFCAP00000022335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]