SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022504 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022504
Domain Number 1 Region: 118-258
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000537
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 2 Region: 649-787
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000196
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 3 Region: 448-574
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000662
Family Spectrin repeat 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000022504
Domain Number - Region: 270-361
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00892
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 867-994
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0129
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022504   Gene: ENSFCAG00000022055   Transcript: ENSFCAT00000024206
Sequence length 1001
Comment pep:novel chromosome:Felis_catus_6.2:B2:139338779:139373645:-1 gene:ENSFCAG00000022055 transcript:ENSFCAT00000024206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQKTNRNKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQLEDMAERFHFVSSTSELHLMK
MEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVELLLQNYISFIENSKFFEQYEVTYQI
LKQTAEMYVKADGSVEEAENVMKFMNETTAQWRNLSVEVRSVRSMLEEVIANWDRYGNTV
ASLQAWLEDAEKMLNQSEHAKKDFFRNLPHWIQQHAAMNDAGNFLIETCDEMVSRDLKQQ
LLLLNGRWRELFMEVKQYARADEMDRMKKEYADCITVLSDFATEAHKKLSEPLEVSFINV
KLLIQDLEDIEQRVPVMDAQYKMITKTAHLITKESSQEEANEMFATMSGLKERLTKVKEC
CPPLLYESQQLLIPLEELEKQMTFFYDSLAKIHEIMAVLEREAQSSALFKQKHQELSACQ
ESCKKTMTQIEKGSQNVQKFVTLSSVLKHFDQTKLHRQIADAHGAFQNMVKKIGDWKKHV
ETNSRLMKKFEESRAELEKVLRIAQEGLEEKGNPEDLLKKHTEFFSQLDQRVLNAFLKAC
DELTDILPEQEQQGLQEAVRKLHKQWKDLQGEAPYHLLHLKIDVEKNRFLASVEECRTEL
DRETTLVPQEGSEKIIKEHRIFFSDKGPHHLCEKRLQLIEELCLKLPVRDPVRNTPETCH
VTLKELRAAIDATYKKLVEDRDKWKDYTRRISEFSSWISAKETQLKGFKNEPIDTANHGE
IKHAVEEIRNGVTTKGETLNWLKSRLKILIEVSSENEAQKQGDELAKLSSSFKALIALLS
EVEKMLSNFGDCVQYKEIVKSSLGELISDSKEVQEQAEKILDTENLFEAQQLLLHHQQKT
KRISAKKRDVQQQIAQAQQGEGGMPGQVRDELRKLESTLDSMEHSREKQERRIQVTLRKW
ERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELEQTKEFSKRTEGIAVQAENLVKE
ASEIPLGPKNKQLLQQQAKTIKEQVKKLEDTLEEEYVLDKS
Download sequence
Identical sequences ENSFCAP00000022504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]