SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022606 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022606
Domain Number 1 Region: 33-87
Classification Level Classification E-value
Superfamily BPTI-like 6.24e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00028
Further Details:      
 
Domain Number 2 Region: 152-207
Classification Level Classification E-value
Superfamily BPTI-like 8.09e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 3 Region: 91-148
Classification Level Classification E-value
Superfamily BPTI-like 9.65e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022606   Gene: ENSFCAG00000031395   Transcript: ENSFCAT00000032147
Sequence length 234
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:97677642:97682171:-1 gene:ENSFCAG00000031395 transcript:ENSFCAT00000032147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTGPLGLLLLPLLLLETVLGDGVQEAPGNNAEICLLPPDEGPCRARIPSYYYDRYTQS
CRKFMYGGCEGNDNNFETWEACDEACWRIEKVPKICRLEVSEGQCGEPREQYFFNLSSMT
CEKFLSGGCHSNENRFPDEATCMGFCAPKKGPSFCYSPKDEGLCSANVTRYYFNPRHKAC
EAFTYTGCGGNENNFINMKDCKHVCVKALKKEKNKKMPKLFFANRRLKIWKRQF
Download sequence
Identical sequences M3X7K4
ENSFCAP00000022606 XP_003982808.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]