SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022658 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022658
Domain Number 1 Region: 166-423
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.01e-79
Family Eukaryotic proteases 0.00000000339
Further Details:      
 
Domain Number 2 Region: 49-163
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-33
Family Kringle modules 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022658   Gene: ENSFCAG00000015567   Transcript: ENSFCAT00000024337
Sequence length 431
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:36856931:36861364:1 gene:ENSFCAG00000015567 transcript:ENSFCAT00000024337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRILMTCLLLCVLVVSDSELTPPPLCSPANCGCLNGGTCVSYKYFSNIQRCSCPKKFQGE
HCEIDTSKTCYQGNGHSYRGKANTDIVGRPCLAWNSAAVLLKEYHALRSDALQLGLGKHN
YCRNPDNQRKPWCYVQVGLNQLVQQCMVHDCSFGKSPLSPPKTAEFQCGQKALRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYLCGGSLISPCWVVSATHCFINNPKKEDYIVYLG
RSKLNSDTLGQMKFEVENLILHEDYSADTLAHHNDIALLKIRSNTGQCAQPSRSIQTICL
PPSYGDAHFGTSCEITGFGKENTTDYLYPEQLKMTSVKLISYQECQQPHYYGSEITTKML
CAADPQWETDSCQGDSGGPLVCSIHGRLTLTGIVSWGSGCAMKDKPGVYTRVSGFLPWIQ
RHTGEQNGLDL
Download sequence
Identical sequences ENSFCAP00000022658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]