SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022679 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022679
Domain Number 1 Region: 216-340
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.37e-52
Family Retrovirus capsid protein, N-terminal core domain 0.00000245
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 1.35e-41
Family MMLV matrix protein-like 0.0000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022679   Gene: ENSFCAG00000031066   Transcript: ENSFCAT00000024063
Sequence length 346
Comment pep:novel chromosome:Felis_catus_6.2:C1:115830811:115831923:1 gene:ENSFCAG00000031066 transcript:ENSFCAT00000024063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQTLTTPLTLTLTHFSDVQARAHNLSLEVRKGRWRTYCSSEWPTLSVGWPRDGTFDLSI
ILQVKTKVMDPGPQGHPDQVAYILTWEDLIRNPPAWVKPFLPSCPLSQSTLLPLKTSKDR
ASTQASDPPKPVLPDESQKDPLLLDALSSPPHNPLLQPPPYNPPLAPALTPPSSTPVPPD
LTPQTPPQTPRLRLRRSDDPNGPPTWQSSLFPLRTVNRTIQYWPFSASDLYNWKTHNPSF
SQEPQALTSLIESILLTHQPTWDDCQQLLQVLLTTEERQRVLLEARKNVPGPGGFPTQLP
NEIDEGFPLTRPDWDYETAPGRESLRIYRQALLAGLKGAGKRPTNL
Download sequence
Identical sequences ENSFCAP00000022679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]